Structure of PDB 4tv0 Chain A Binding Site BS01

Receptor Information
>4tv0 Chain A (length=47) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TEADPAILSRRQKQIDYGKNTAATPNKYGKYSRRAFDGMVKIWRKSM
Ligand information
>4tv0 Chain B (length=26) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggccaaaggcccuuuucagggccacc
.......<<<<<<....>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tv0 Molecular mechanisms for the regulation of histone mRNA stem-loop-binding protein by phosphorylation.
Resolution2.601 Å
Binding residue
(original residue number in PDB)		Y204 S238 R239 R240 A241 G244 M245 R250 K251
Binding residue
(residue number reindexed from 1)		Y17 S32 R33 R34 A35 G38 M39 R44 K45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding

View graph for
Molecular Function
External links
PDB RCSB:4tv0, PDBe:4tv0, PDBj:4tv0
PDBsum4tv0
PubMed25002523
UniProtQ9VAN6|SLBP_DROME Histone RNA hairpin-binding protein (Gene Name=Slbp)

[Back to BioLiP]