Structure of PDB 4tuj Chain A Binding Site BS01

Receptor Information
>4tuj Chain A (length=208) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLLQSGPELEKPGASVMISCKASGSSFTGYNMNWVRQNIGKSLEWIGA
IDPYYGGTSYNQKFKGRATLTVDKSSSTAYMHLKSLTSEDSAVYYCVSGM
EYWGQGTSVTVSSAKTTAPSVYPLAPVTGSSVTLGCLVKGYFPEPVTLTW
NSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASST
KVDKKIEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tuj Structural Basis of GD2 Ganglioside and Mimetic Peptide Recognition by 14G2a Antibody.
Resolution1.89 Å
Binding residue
(original residue number in PDB)		Y32 N33 A50 D52 G57 T58 S59 G99 E101
Binding residue
(residue number reindexed from 1)		Y32 N33 A50 D52 G57 T58 S59 G99 E101
External links