Structure of PDB 4tui Chain A Binding Site BS01

Receptor Information
>4tui Chain A (length=317) Species: 243232 (Methanocaldococcus jannaschii DSM 2661) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLH
SGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESP
LALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESE
AKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFN
DGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIEC
REFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKIL
INKAIIVDDEFIDMPDN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tui DNA end recognition by the Mre11 nuclease dimer: insights into resection and repair of damaged DNA.
Resolution3.59 Å
Binding residue
(original residue number in PDB)		L91 S131
Binding residue
(residue number reindexed from 1)		L95 S135
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000403 Y-form DNA binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004527 exonuclease activity
GO:0004529 DNA exonuclease activity
GO:0008408 3'-5' exonuclease activity
GO:0016787 hydrolase activity
GO:0030145 manganese ion binding
GO:0042802 identical protein binding
GO:0045027 DNA end binding
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006302 double-strand break repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4tui, PDBe:4tui, PDBj:4tui
PDBsum4tui
PubMed25107472
UniProtQ58719|MRE11_METJA DNA double-strand break repair protein Mre11 (Gene Name=mre11)

[Back to BioLiP]