Structure of PDB 4tu8 Chain A Binding Site BS01

Receptor Information
>4tu8 Chain A (length=174) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQIN
QDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLF
IGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINV
TDQAIAGLNGMQLGDKKLLVQRAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tu8 Structure-guided U2AF65 variant improves recognition and splicing of a defective pre-mRNA.
Resolution1.918 Å
Binding residue
(original residue number in PDB)
R150 Y152 K195 N196 F197 F199 K225 R227 P229 H230 D231
Binding residue
(residue number reindexed from 1)
R8 Y10 K53 N54 F55 F57 K83 R85 P87 H88 D89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4tu8, PDBe:4tu8, PDBj:4tu8
PDBsum4tu8
PubMed25422459
UniProtP26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit (Gene Name=U2AF2)

[Back to BioLiP]