Structure of PDB 4tt2 Chain A Binding Site BS01

Receptor Information
>4tt2 Chain A (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQP
MDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRA
CALRDTAYAIIKEELDEDFEQLCEEIQESR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tt2 Observed bromodomain flexibility reveals histone peptide- and small molecule ligand-compatible forms of ATAD2.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
V1013 D1020 Y1063 I1074
Binding residue
(residue number reindexed from 1)
V35 D42 Y85 I96
Enzymatic activity
Enzyme Commision number 3.6.1.-
External links
PDB RCSB:4tt2, PDBe:4tt2, PDBj:4tt2
PDBsum4tt2
PubMed25486442
UniProtQ6PL18|ATAD2_HUMAN ATPase family AAA domain-containing protein 2 (Gene Name=ATAD2)

[Back to BioLiP]