Structure of PDB 4tjx Chain A Binding Site BS01

Receptor Information
>4tjx Chain A (length=153) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKS
YSDFDISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSKA
EPLITMDTPDYLQNITIPSALITKTLGDSIKSALSGGDMVNMKLDWTESV
PHP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tjx How vacuolar sorting receptor proteins interact with their cargo proteins: crystal structures of apo and cargo-bound forms of the protease-associated domain from an Arabidopsis vacuolar sorting receptor.
Resolution1.902 Å
Binding residue
(original residue number in PDB)
R95 Y99 F100 M128 D129
Binding residue
(residue number reindexed from 1)
R73 Y77 F78 M106 D107
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4tjx, PDBe:4tjx, PDBj:4tjx
PDBsum4tjx
PubMed25271241
UniProtP93026|VSR1_ARATH Vacuolar-sorting receptor 1 (Gene Name=VSR1)

[Back to BioLiP]