Structure of PDB 4s1x Chain A Binding Site BS01

Receptor Information
>4s1x Chain A (length=38) Species: 11309 (unidentified influenza virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WGSIDQINGKMNRVIEKFHQIEKEFSEVEGRIQDMEKY
Ligand information
>4s1x Chain C (length=22) Species: 11309 (unidentified influenza virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IDQINGKMNRVIEKFHQIEKEF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4s1x A switch from parallel to antiparallel strand orientation in a coiled-coil X-ray structure via two core hydrophobic mutations.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		W42 I45 D46 N49 M52 I56 F63 H64
Binding residue
(residue number reindexed from 1)		W1 I4 D5 N8 M11 I15 F18 H19
Enzymatic activity
Enzyme Commision number ?
External links