Structure of PDB 4s0n Chain A Binding Site BS01

Receptor Information
>4s0n Chain A (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNG
NQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEE
NRKAVSDQLKKHGFKLGPAPKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4s0n HLTF's Ancient HIRAN Domain Binds 3' DNA Ends to Drive Replication Fork Reversal.
Resolution1.501 Å
Binding residue
(original residue number in PDB)		G69 Y72 Y73 Y93 D94 H110 K112 K113 F142
Binding residue
(residue number reindexed from 1)		G14 Y17 Y18 Y38 D39 H55 K57 K58 F87
Binding affinityPDBbind-CN: Kd=13nM
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
3.6.4.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides

View graph for
Molecular Function
External links
PDB RCSB:4s0n, PDBe:4s0n, PDBj:4s0n
PDBsum4s0n
PubMed26051180
UniProtQ14527|HLTF_HUMAN Helicase-like transcription factor (Gene Name=HLTF)

[Back to BioLiP]