Structure of PDB 4rwo Chain A Binding Site BS01

Receptor Information
>4rwo Chain A (length=347) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MELRHTPARDLDKFIEDHLLPNTCFRTQVKEAIDIVCRFLKERCFQGTAD
PVRVSKVVKGGSSGKGTTLRGRSDADLVVFLTKLTSFEDQLRRRGEFIQE
IRRQLEACQREQKFKVTFEVQSPRRENPRALSFVLSSPQLQQEVEFDVRP
AFDALGQWTPGYKPNPEIYVQLIKECKSRGKEGEFSTCFTELQRDFLRNR
PTKLKSLIRLVKHWYQTCKKTHGNKLPPQYALELLTVYAWEQGSRKTDFS
TAQGFQTVLELVLKHQKLCIFWEAYYDFTNPVVGRCMLQQLKKPRPVILD
PADPTGNVGGGDTHSWQRLAQEARVWLGYPCCKNLDGSLVGAWTMLQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rwo The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		P21 T23 R26 K41 E42 R53 V54 S55 G66 R198 N199 K205
Binding residue
(residue number reindexed from 1)		P21 T23 R26 K41 E42 R53 V54 S55 G66 R198 N199 K205
Enzymatic activity
Enzyme Commision number 2.7.7.84: 2'-5' oligoadenylate synthase.
Gene Ontology
Molecular Function
GO:0001730 2'-5'-oligoadenylate synthetase activity
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0005524 ATP binding
GO:0016779 nucleotidyltransferase activity
GO:0046872 metal ion binding
Biological Process
GO:0045071 negative regulation of viral genome replication
GO:0045087 innate immune response
GO:0051607 defense response to virus
GO:0060700 regulation of ribonuclease activity
GO:1904188 negative regulation of transformation of host cell by virus
Cellular Component
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4rwo, PDBe:4rwo, PDBj:4rwo
PDBsum4rwo
PubMed25892109
UniProtQ29599|OAS1_PIG 2'-5'-oligoadenylate synthase 1 (Gene Name=OAS1)

[Back to BioLiP]