Structure of PDB 4rua Chain A Binding Site BS01

Receptor Information

>4rua Chain A (length=341) Species: 273057 (Saccharolobus solfataricus P2)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

Ligand information

>4rua Chain T (length=17)

catggaatccttccccc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4rua Structural Basis for Error-Free Bypass of the 5-N-Methylformamidopyrimidine-dG Lesion by Human DNA Polymerase eta and Sulfolobus solfataricus P2 Polymerase IV.
• Resolution: 3.07 Å
• Binding residue (original residue number in PDB): V32 F37 S40 G41 A42 G218 E219 R242 K243 S244 I245 G246 R247 I248 T250 R331 R332 R336
• Binding residue (residue number reindexed from 1): V32 F37 S40 G41 A42 G218 E219 R242 K243 S244 I245 G246 R247 I248 T250 R331 R332 R336

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4rua, PDBe:4rua, PDBj:4rua
• PDBsum: 4rua
• PubMed: 25988947
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)