Structure of PDB 4rtz Chain A Binding Site BS01

Receptor Information
>4rtz Chain A (length=61) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTG
YIPSNYVAPSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rtz Crystal structure of the c-Src-SH3 domain in complex with the high affinity peptide VSL12
Resolution0.979 Å
Binding residue
(original residue number in PDB)
Y90 T96 D99 W118 P133 N135 Y136
Binding residue
(residue number reindexed from 1)
Y10 T16 D19 W38 P53 N55 Y56
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:4rtz, PDBe:4rtz, PDBj:4rtz
PDBsum4rtz
PubMed
UniProtP00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]