Structure of PDB 4rty Chain A Binding Site BS01

Receptor Information
>4rty Chain A (length=58) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIP
SNYVAPSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rty Crystal structure of the c-Src-SH3 domain in complex with the high affinity peptide APP12
Resolution1.279 Å
Binding residue
(original residue number in PDB)
Y90 R95 T96 D99 E115 G116 D117 W118 P133 N135 Y136
Binding residue
(residue number reindexed from 1)
Y7 R12 T13 D16 E32 G33 D34 W35 P50 N52 Y53
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:4rty, PDBe:4rty, PDBj:4rty
PDBsum4rty
PubMed
UniProtP00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]