Structure of PDB 4rtv Chain A Binding Site BS01

Receptor Information

>4rtv Chain A (length=57) Species: 9031 (Gallus gallus)

MTFVALYDYEARTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIP
SNYVAPS

Ligand information

>4rtv Chain B (length=10) Species: 32630 (synthetic construct)

APPLPPRNRP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4rtv Crystal structure of the Src tyrosine kinase SH3 domain S94A/Q128R mutant in complex with the high affinity synthetic peptide APP12
• Resolution: 1.37 Å
• Binding residue (original residue number in PDB): Y90 Y92 R95 T96 D99 E115 G116 D117 W118 P133 N135 Y136
• Binding residue (residue number reindexed from 1): Y7 Y9 R12 T13 D16 E32 G33 D34 W35 P50 N52 Y53

Enzymatic activity

• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

External links

• PDB: RCSB:4rtv, PDBe:4rtv, PDBj:4rtv
• PDBsum: 4rtv
• UniProt: P00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)