Structure of PDB 4rtm Chain A Binding Site BS01

Receptor Information

>4rtm Chain A (length=245) Species: 1110693 (Escherichia coli str. K-12 substr. MDS42)

KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYIL
ADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQ
DPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFA
EKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSNSFTLEQQAHLAEI
AEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKKVDELLALYKP

Ligand information

>4rtm Chain G (length=11)

acgatctttag

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4rtm Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): R95 R124 N126 L127 N132 P134
• Binding residue (residue number reindexed from 1): R93 R122 N124 L125 N130 P132

Enzymatic activity

• Enzyme Commision number: 2.1.1.72: site-specific DNA-methyltransferase (adenine-specific).

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0009007 site-specific DNA-methyltransferase (adenine-specific) activity
• GO:0043565 sequence-specific DNA binding
• GO:1904047 S-adenosyl-L-methionine binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006298 mismatch repair
• GO:0009307 DNA restriction-modification system
• GO:0009411 response to UV
• GO:0032259 methylation
• GO:1902328 bacterial-type DNA replication initiation

External links

• PDB: RCSB:4rtm, PDBe:4rtm, PDBj:4rtm
• PDBsum: 4rtm
• PubMed: 25845600
• UniProt: P0AEE8|DMA_ECOLI DNA adenine methylase (Gene Name=dam)