Structure of PDB 4rtl Chain A Binding Site BS01

Receptor Information
>4rtl Chain A (length=254) Species: 1110693 (Escherichia coli str. K-12 substr. MDS42) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYIL
ADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQ
DPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFA
EKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSANSFTLEQQAHLAE
IAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVRRSIRKKVDELLAL
YKPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rtl Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
Resolution2.193 Å
Binding residue
(original residue number in PDB)		R95 R124 N126 L127
Binding residue
(residue number reindexed from 1)		R93 R122 N124 L125
Enzymatic activity
Enzyme Commision number 2.1.1.72: site-specific DNA-methyltransferase (adenine-specific).
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0009007 site-specific DNA-methyltransferase (adenine-specific) activity
GO:0043565 sequence-specific DNA binding
GO:1904047 S-adenosyl-L-methionine binding
Biological Process
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006298 mismatch repair
GO:0009307 DNA restriction-modification system
GO:0009411 response to UV
GO:0032259 methylation
GO:1902328 bacterial-type DNA replication initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4rtl, PDBe:4rtl, PDBj:4rtl
PDBsum4rtl
PubMed25845600
UniProtP0AEE8|DMA_ECOLI DNA adenine methylase (Gene Name=dam)

[Back to BioLiP]