Structure of PDB 4rs9 Chain A Binding Site BS01

Receptor Information
>4rs9 Chain A (length=171) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQFNEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGD
GYYKGENTAEQEHRKRVIRELNSLEEVTDTEWFFLVSMTQSFVNGVGLPG
ESFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIATQNGVVELGS
SEVISQSSDLMHKVNNLFNFN
Ligand information
>4rs9 Chain B (length=19) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SVPQARKASLARFLEKRKE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rs9 Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		Q53 W92 D94 Y96 Y97 N126 E142 E143 E148 F151 M155
Binding residue
(residue number reindexed from 1)		Q9 W48 D50 Y52 Y53 N72 E75 E76 E81 F84 M88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4rs9, PDBe:4rs9, PDBj:4rs9
PDBsum4rs9
PubMed26258305
UniProtQ9FIP9|MYC3_ARATH Transcription factor MYC3 (Gene Name=MYC3)

[Back to BioLiP]