Structure of PDB 4roj Chain A Binding Site BS01

Receptor Information
>4roj Chain A (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDE
VKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYP
YKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4roj Crystal Structure of the VAV2 SH2 domain in complex with TXNIP phosphorylated peptide
Resolution1.95 Å
Binding residue
(original residue number in PDB)
R680 R698 R700 K718 H719 K721 F756
Binding residue
(residue number reindexed from 1)
R14 R32 R34 K52 H53 K55 F90
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4roj, PDBe:4roj, PDBj:4roj
PDBsum4roj
PubMed
UniProtP52735|VAV2_HUMAN Guanine nucleotide exchange factor VAV2 (Gene Name=VAV2)

[Back to BioLiP]