Structure of PDB 4rmc Chain A Binding Site BS01

Receptor Information

>4rmc Chain A (length=214) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EDMPVERILEAELAVEPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPL
DDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGA
IFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALRE
KVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGD
TPIDTFLMEMLEAP

Ligand information

>4rmc Chain B (length=11) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KHKILHRLLQD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4rmc Conformationally Defined Rexinoids and Their Efficacy in the Prevention of Mammary Cancers.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	V280 K284 L294 V298 R302 T449 F450 E453
Binding residue (residue number reindexed from 1)	V36 K40 L50 V54 R58 T205 F206 E209

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003707	nuclear steroid receptor activity
GO:0008270	zinc ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4rmc, PDBe:4rmc, PDBj:4rmc
PDBsum	4rmc
PubMed	26331194
UniProt	P19793\|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]