Structure of PDB 4rdm Chain A Binding Site BS01

Receptor Information
>4rdm Chain A (length=165) Species: 242231 (Neisseria gonorrhoeae FA 1090) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HLENCLGVQKIAPEQIRQLFAQTSEYHFSIPAKTEEKSNLNVFFGEGRRD
KRGFVKPRPWYEVELIVSKDITSQEGYPVLKSFTVITDDGWQFQCKTSGD
YSKNFRSENDLKTLGKWIKGRLESHGCLQNNEKITHETLREYGNDHFELR
STDNPDVWLLSFKGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rdm Crystal structure of the R-protein of the multisubunit ATP-dependent restriction endonuclease NgoAVII.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R227 K235 K275 S277 G278 D279 K282 N283 R285 N288 D289 L290
Binding residue
(residue number reindexed from 1)		R48 K56 K96 S98 G99 D100 K103 N104 R106 N109 D110 L111
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
External links