Structure of PDB 4rd5 Chain A Binding Site BS01

Receptor Information
>4rd5 Chain A (length=160) Species: 242231 (Neisseria gonorrhoeae FA 1090) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGVQKIAPEQIRQLFAQTSEYHFSIPAKTEEKSNLNVFFGEGRRDKRGFV
KPRPWYEVELIVSKDITSQEGYPVLKSFTVITDDGWQFQCKTSGDYSKNF
RSENDLKTLGKWIKGRLESHGCLQNNEKITHETLREYGNDHFELRSTDNP
DVWLLSFKGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rd5 Crystal structure of the R-protein of the multisubunit ATP-dependent restriction endonuclease NgoAVII.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R227 K235 S277 G278 D279 K282 N283 R285 E287 N288 D289 L290
Binding residue
(residue number reindexed from 1)		R43 K51 S93 G94 D95 K98 N99 R101 E103 N104 D105 L106
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
External links