Structure of PDB 4rcj Chain A Binding Site BS01

Receptor Information
>4rcj Chain A (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCST
EHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGV
WSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLE
KAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rcj Structural Basis for the Discriminative Recognition of N6-Methyladenosine RNA by the Human YT521-B Homology Domain Family of Proteins.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		K395 S396 Y397 D401 W411 C412 N441 G442 W465 K469 W470 N504 S505 R506 D507
Binding residue
(residue number reindexed from 1)		K31 S32 Y33 D37 W47 C48 N77 G78 W101 K105 W106 N140 S141 R142 D143
Binding affinityPDBbind-CN: Kd=22uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4rcj, PDBe:4rcj, PDBj:4rcj
PDBsum4rcj
PubMed26318451
UniProtQ9BYJ9|YTHD1_HUMAN YTH domain-containing family protein 1 (Gene Name=YTHDF1)

[Back to BioLiP]