Structure of PDB 4rbo Chain A Binding Site BS01

Receptor Information

>4rbo Chain A (length=55) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMK
SKRWQ

Ligand information

>4rbo Chain B (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggcccattcaag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4rbo Structure-based discovery of NANOG variant with enhanced properties to promote self-renewal and reprogramming of pluripotent stem cells.
Resolution	3.3 Å
Binding residue (original residue number in PDB)	Y119 Y136 K140 Q144 R147 M148 K151
Binding residue (residue number reindexed from 1)	Y20 Y37 K41 Q45 R48 M49 K52
Binding affinity	PDBbind-CN: Kd=5.9uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4rbo, PDBe:4rbo, PDBj:4rbo
PDBsum	4rbo
PubMed	25825768
UniProt	Q9H9S0\|NANOG_HUMAN Homeobox protein NANOG (Gene Name=NANOG)

[Back to BioLiP]