Structure of PDB 4rb1 Chain A Binding Site BS01

Receptor Information
>4rb1 Chain A (length=132) Species: 1430440 (Magnetospirillum gryphiswaldense MSR-1 v2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRIS
IATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIE
FTSPEIEALQREIARKHGFRLVGHRLELYGVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rb1 Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		K15 V16 Y56
Binding residue
(residue number reindexed from 1)		K14 V15 Y55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:1900705 negative regulation of siderophore biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4rb1, PDBe:4rb1, PDBj:4rb1
PDBsum4rb1
PubMed26134419
UniProtV6F4Q0

[Back to BioLiP]