Structure of PDB 4rav Chain A Binding Site BS01

Receptor Information
>4rav Chain A (length=118) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQESGGGLVQPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVAV
ISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDR
YFDLWGRGTLVTVSSGGG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rav Structure of a single-chain fv bound to the 17 N-terminal residues of huntingtin provides insights into pathogenic amyloid formation and suppression.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		S31 S33 V50 S52 Y53 N57 Y59 D99 R100
Binding residue
(residue number reindexed from 1)		S31 S33 V50 S52 Y53 N57 Y59 D99 R100
External links