Structure of PDB 4r79 Chain A Binding Site BS01

Receptor Information
>4r79 Chain A (length=336) Species: 7226 (Drosophila mauritiana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFK
SGDFDVDDKEHGKPPKRYEDAELQALLDEDDAQTQKQLAEQLEVSQQAVS
NRLREMGKIQKVGRWVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVT
GDEKWIFFVNPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVIY
YELLKPGETVNAARYQQQLINLNRALQRKRPEYRVIFLHDNAPSHTARAV
RDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKW
LDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4r79 Structural Basis for the Inverted Repeat Preferences of mariner Transposases.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		K8 T42 K44 T45 R48 D62 K63 G66 T88 Q89 Q100 Q101 S104
Binding residue
(residue number reindexed from 1)		K4 T38 K40 T41 R44 D58 K59 G62 T84 Q85 Q96 Q97 S100
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000014 single-stranded DNA endodeoxyribonuclease activity
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003697 single-stranded DNA binding
GO:0004519 endonuclease activity
GO:0042800 histone H3K4 methyltransferase activity
GO:0044547 DNA topoisomerase binding
GO:0046872 metal ion binding
GO:0046975 histone H3K36 methyltransferase activity
Biological Process
GO:0000729 DNA double-strand break processing
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0006310 DNA recombination
GO:0006338 chromatin remodeling
GO:0015074 DNA integration
GO:0031297 replication fork processing
GO:0044774 mitotic DNA integrity checkpoint signaling
Cellular Component
GO:0000793 condensed chromosome
GO:0005634 nucleus
GO:0035861 site of double-strand break

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4r79, PDBe:4r79, PDBj:4r79
PDBsum4r79
PubMed25869132
UniProtQ7JQ07|MOS1T_DROMA Mariner Mos1 transposase (Gene Name=mariner\T)

[Back to BioLiP]