Structure of PDB 4r5i Chain A Binding Site BS01

Receptor Information
>4r5i Chain A (length=222) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HIEGRVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQ
SAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGI
LHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELV
QTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAA
IEAKMQELAQVSQKLMEIAQQQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4r5i Structural Basis for the Inhibition of HSP70 and DnaK Chaperones by Small-Molecule Targeting of a C-Terminal Allosteric Pocket.
Resolution1.9702 Å
Binding residue
(original residue number in PDB)		T403 T409 V425 F426 S427 A429 Q433 V436 T437
Binding residue
(residue number reindexed from 1)		T20 T26 V42 F43 S44 A46 Q50 V53 T54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0140662 ATP-dependent protein folding chaperone

View graph for
Molecular Function
External links
PDB RCSB:4r5i, PDBe:4r5i, PDBj:4r5i
PDBsum4r5i
PubMed25148104
UniProtP0A6Y8|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]