Structure of PDB 4r55 Chain A Binding Site BS01

Receptor Information
>4r55 Chain A (length=53) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGKKPVKVKTPAGKEAELVPEKVWALGRVKIGLFKDPETGKYFRHKLPDD
YPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4r55 Insights into the interaction between Cren7 and DNA: the role of loop beta 3-beta 4
Resolution1.8 Å
Binding residue
(original residue number in PDB)		K24 W26 L28 Y44 R46
Binding residue
(residue number reindexed from 1)		K22 W24 L26 Y42 R44
Binding affinityPDBbind-CN: Kd=1.67uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4r55, PDBe:4r55, PDBj:4r55
PDBsum4r55
PubMed25555709
UniProtQ97ZE3|CREN7_SACS2 Chromatin protein Cren7 (Gene Name=creN7)

[Back to BioLiP]