Structure of PDB 4r3i Chain A Binding Site BS01

Receptor Information
>4r3i Chain A (length=164) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTSKLKYVLQDARFFLIKSNNHENVSLAKAKGVWSTLPVNEKKLNLAFRS
ARSVILIFSVRESGKFQGFARLSSESHHGGSPIHWVLPAGMSAKMLGGVF
KIDWICRRELPFTKSAHLTNPWNEHKPVKIGRDGQEIELECGTQLCLLFP
PDESIDLYQVIHKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4r3i Structural basis for selective binding of m(6)A RNA by the YTHDC1 YTH domain.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		K361 S362 N363 N367 W377 S378 L380 P381 V382 R404 E405 W428 M434 K472 I473 G474 R475 D476
Binding residue
(residue number reindexed from 1)		K18 S19 N20 N24 W34 S35 L37 P38 V39 R61 E62 W85 M91 K129 I130 G131 R132 D133
Binding affinityPDBbind-CN: Kd=2uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4r3i, PDBe:4r3i, PDBj:4r3i
PDBsum4r3i
PubMed25242552
UniProtQ96MU7|YTDC1_HUMAN YTH domain-containing protein 1 (Gene Name=YTHDC1)

[Back to BioLiP]