Structure of PDB 4r2r Chain A Binding Site BS01

Receptor Information
>4r2r Chain A (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHL
KTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4r2r Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
Resolution2.089 Å
Binding residue
(original residue number in PDB)		R362 F364 R366 Q369 R372 H373 R376 R390 R394 H397 H401 T404 R424 R430
Binding residue
(residue number reindexed from 1)		R14 F16 R18 Q21 R24 H25 R28 R42 R46 H49 H53 T56 R76 R82
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4r2r, PDBe:4r2r, PDBj:4r2r
PDBsum4r2r
PubMed25258363
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]