Structure of PDB 4r2q Chain A Binding Site BS01

Receptor Information
>4r2q Chain A (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHL
KTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4r2q Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
Resolution1.54 Å
Binding residue
(original residue number in PDB)		R362 R366 Q369 R372 H373 R376 R390 S393 R394 H397 H401 T404 R424 E427 R430
Binding residue
(residue number reindexed from 1)		R14 R18 Q21 R24 H25 R28 R42 S45 R46 H49 H53 T56 R76 E79 R82
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4r2q, PDBe:4r2q, PDBj:4r2q
PDBsum4r2q
PubMed25258363
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]