Structure of PDB 4r2d Chain A Binding Site BS01

Receptor Information
>4r2d Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLT
THIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4r2d Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
Resolution2.088 Å
Binding residue
(original residue number in PDB)		R351 E354 R357 I361 R375 F377 R379 H382 H386 T389 R407 R413
Binding residue
(residue number reindexed from 1)		R17 E20 R23 I27 R41 F43 R45 H48 H52 T55 R73 R79
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4r2d, PDBe:4r2d, PDBj:4r2d
PDBsum4r2d
PubMed25258363
UniProtP18146|EGR1_HUMAN Early growth response protein 1 (Gene Name=EGR1)

[Back to BioLiP]