Structure of PDB 4qy8 Chain A Binding Site BS01

Receptor Information
>4qy8 Chain A (length=114) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQSGDELVKPGASVKLSCTVSGFNIKDDFIHWMKQRPEQGLEWIGR
IDPANGYTKYAPKFQDKATMTADTSSNTAYLQLSSLASEDAAVYYCATYG
VAYWGQGTLVTVSA
Ligand information
>4qy8 Chain Q (length=14) Species: 36329 (Plasmodium falciparum 3D7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NAYNMSIRRSMAES
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qy8 Structural basis for epitope masking and strain specificity of a conserved epitope in an intrinsically disordered malaria vaccine candidate.
Resolution1.353 Å
Binding residue
(original residue number in PDB)		D31 D32 F33 R50 D52 Y57 Y99 G100 V101
Binding residue
(residue number reindexed from 1)		D31 D32 F33 R50 D52 Y57 Y99 G100 V101
External links