Structure of PDB 4qvi Chain A Binding Site BS01

Receptor Information
>4qvi Chain A (length=229) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGI
DPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEI
IQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNI
GEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAH
KPEGAKGTFLRSVYVTTTLGPSVRINPHS
Ligand information
>4qvi Chain B (length=80) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggaugcguaggauaggugggagccugugaacccccgccuccgggugggg
gggaggcgccggugaaauaccacccuuccc
<<<<...........<<<<<..<<<......<<<<<<<<....>>>>>>>
>...>>>............>>>>>..>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qvi Protein-RNA affinity of ribosomal protein L1 mutants does not correlate with the number of intermolecular interactions.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		M0 H3 G4 K5 R6 Y7 A35 K36 T40 E42 H44 K46 R134 D166 T168 H172 S211 Y213 T215 T217 L218 G219 S221
Binding residue
(residue number reindexed from 1)		M1 H4 G5 K6 R7 Y8 A36 K37 T41 E43 H45 K47 R135 D167 T169 H173 S212 Y214 T216 T218 L219 G220 S222
Binding affinityPDBbind-CN: Kd=0.148uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4qvi, PDBe:4qvi, PDBj:4qvi
PDBsum4qvi
PubMed25664749
UniProtP27150|RL1_THETH Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]