Structure of PDB 4qvf Chain A Binding Site BS01

Receptor Information
>4qvf Chain A (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQSNRELVVDFLSYKLSQKGYSWSQFSDVAVKQALREAGDEFELRYRRAF
SDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESV
DKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYG
Ligand information
>4qvf Chain B (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PEIWIAQELRRIGDEFNAYYA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qvf Bh3 induced conformational changes in Bcl-Xl revealed by crystal structure and comparative analysis.
Resolution1.531 Å
Binding residue
(original residue number in PDB)		E96 F97 R100 Y101 F105 L108 Q111 S122 V126 E129 L130 N136 G138 R139 Y195
Binding residue
(residue number reindexed from 1)		E41 F42 R45 Y46 F50 L53 Q56 S67 V71 E74 L75 N81 G83 R84 Y140
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4qvf, PDBe:4qvf, PDBj:4qvf
PDBsum4qvf
PubMed25907960
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]