Structure of PDB 4quf Chain A Binding Site BS01

Receptor Information
>4quf Chain A (length=57) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDF
ESEVFRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4quf Transgenerationally inherited piRNAs trigger piRNA biogenesis by changing the chromatin of piRNA clusters and inducing precursor processing.
Resolution2.501 Å
Binding residue
(original residue number in PDB)		E23 Y24 V25 V26 W45 F48 E56 N60 N63 C64 K66 L67
Binding residue
(residue number reindexed from 1)		E2 Y3 V4 V5 W24 F27 E35 N39 N42 C43 K45 L46
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4quf, PDBe:4quf, PDBj:4quf
PDBsum4quf
PubMed25085419
UniProtQ7JXA8|RHINO_DROME Chromo domain-containing protein rhino (Gene Name=rhi)

[Back to BioLiP]