Structure of PDB 4qu7 Chain A Binding Site BS01

Receptor Information
>4qu7 Chain A (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MHFVHMRGLPFQANAQDIINFFAPLKPVRITMEYSSSGKATGEADVHFET
HEDAVAAMLKDRSHVHHRYIELFLNSCPKGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qu7 Crystal structure of a G-rich RNA sequence binding factor 1 (GRSF1) from Homo sapiens at 2.50 A resolution
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R406 G407 F410 R467 Y468 E470
Binding residue
(residue number reindexed from 1)		R7 G8 F11 R68 Y69 E71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4qu7, PDBe:4qu7, PDBj:4qu7
PDBsum4qu7
PubMed
UniProtQ12849|GRSF1_HUMAN G-rich sequence factor 1 (Gene Name=GRSF1)

[Back to BioLiP]