Structure of PDB 4qt7 Chain A Binding Site BS01

Receptor Information

>4qt7 Chain A (length=60) Species: 9031 (Gallus gallus)

SHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGY
IPSNYVAPSD

Ligand information

>4qt7 Chain B (length=8)

APPIPPPR

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4qt7 Structure of the c-Src-SH3 domain in complex with a proline-rich motif of NS5A protein from the hepatitis C virus.
• Resolution: 1.55 Å
• Binding residue (original residue number in PDB): Y90 R95 T98 D99 D117 W118 Y131 N135 Y136
• Binding residue (residue number reindexed from 1): Y9 R14 T17 D18 D36 W37 Y50 N54 Y55

Enzymatic activity

• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

External links

• PDB: RCSB:4qt7, PDBe:4qt7, PDBj:4qt7
• PDBsum: 4qt7
• PubMed: 25447263
• UniProt: P00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)