Structure of PDB 4qsy Chain A Binding Site BS01

Receptor Information
>4qsy Chain A (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHI
KIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qsy Selective targeting of GAB adapter protein SHP2 tyrosine phosphatase interaction attenuates ERK signaling
Resolution2.1 Å
Binding residue
(original residue number in PDB)
V14 R32 S34 K35 S36 T42 T52 H53 I54 K55 L65 G67 G68 K89 E90 K91 I96
Binding residue
(residue number reindexed from 1)
V10 R28 S30 K31 S32 T38 T48 H49 I50 K51 L61 G63 G64 K85 E86 K87 I92
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:4qsy, PDBe:4qsy, PDBj:4qsy
PDBsum4qsy
PubMed
UniProtQ06124|PTN11_HUMAN Tyrosine-protein phosphatase non-receptor type 11 (Gene Name=PTPN11)

[Back to BioLiP]