Structure of PDB 4qrt Chain A Binding Site BS01

Receptor Information
>4qrt Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAP
WIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYG
CDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAA
RVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qrt Molecular imprint of exposure to naturally occurring genetic variants of human cytomegalovirus on the T cell repertoire.
Resolution1.4 Å
Binding residue
(original residue number in PDB)
Y7 D9 R62 N63 I66 F67 N70 T73 D74 E76 S77 N80 L81 Y84 S97 Y99 Y116 T143 K146 W147 V152 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 D9 R62 N63 I66 F67 N70 T73 D74 E76 S77 N80 L81 Y84 S97 Y99 Y116 T143 K146 W147 V152 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4qrt, PDBe:4qrt, PDBj:4qrt
PDBsum4qrt
PubMed24509977
UniProtP01889|HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain (Gene Name=HLA-B)

[Back to BioLiP]