Structure of PDB 4qqb Chain A Binding Site BS01

Receptor Information
>4qqb Chain A (length=169) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVD
FTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTI
TDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL
NNVIPEGGSQPLSVRLAEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qqb Structural basis for the assembly of the Sxl-Unr translation regulatory complex.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		N130 Y131 Q134 D138 R139 Y142 R146 A147 R155 M157 R158 Y160 K161 G163 S165 F166 G167 Y168 F170 K194 R195 K197 A201 R202 G204 V238 N241 L243 F256 R258 E290
Binding residue
(residue number reindexed from 1)		N8 Y9 Q12 D16 R17 Y20 R24 A25 R33 M35 R36 Y38 K39 G41 S43 F44 G45 Y46 F48 K72 R73 K75 A79 R80 G82 V116 N119 L121 F134 R136 E168
Binding affinityPDBbind-CN: Kd=1.24nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Cellular Component
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4qqb, PDBe:4qqb, PDBj:4qqb
PDBsum4qqb
PubMed25209665
UniProtP19339|SXL_DROME Protein sex-lethal (Gene Name=Sxl)

[Back to BioLiP]