Structure of PDB 4qk4 Chain A Binding Site BS01

Receptor Information

>4qk4 Chain A (length=244) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SGGPNVPELILQLLQLEPDEDQVRARILGSLQEPTKSRPDQPAAFGLLCR
MADQTFISIVDWARRCMVFKELEVADQMTLLQNCWSELLVFDHIYRQVQH
GKEGSILLVTGQEVELTTVATQAGSLLHSLVLRAQELVLQLLALQLDRQE
FVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHSGDKFQ
QLLLCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT

Ligand information

>4qk4 Chain B (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PSLLKKLLLAPA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4qk4 The signaling phospholipid PIP3 creates a new interaction surface on the nuclear receptor SF-1.
Resolution	2.81 Å
Binding residue (original residue number in PDB)	R281 M295 E454 M455
Binding residue (residue number reindexed from 1)	R64 M78 E237 M238

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

View graph for
Molecular Function

External links

PDB	RCSB:4qk4, PDBe:4qk4, PDBj:4qk4
PDBsum	4qk4
PubMed	25288771
UniProt	Q13285\|STF1_HUMAN Steroidogenic factor 1 (Gene Name=NR5A1)

[Back to BioLiP]