Structure of PDB 4qju Chain A Binding Site BS01

Receptor Information
>4qju Chain A (length=90) Species: 158878 (Staphylococcus aureus subsp. aureus Mu50) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNF
EVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qju beta-Arm flexibility of HU from Staphylococcus aureus dictates the DNA-binding and recognition mechanism
Resolution2.16 Å
Binding residue
(original residue number in PDB)		R58 G60 P63 Q64 I71
Binding residue
(residue number reindexed from 1)		R58 G60 P63 Q64 I71
Binding affinityPDBbind-CN: Kd=370nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
Biological Process
GO:0030261 chromosome condensation
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4qju, PDBe:4qju, PDBj:4qju
PDBsum4qju
PubMed25478845
UniProtQ99U17|DBH_STAAM DNA-binding protein HU (Gene Name=hup)

[Back to BioLiP]