Structure of PDB 4qi2 Chain A Binding Site BS01

Receptor Information

>4qi2 Chain A (length=153) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HQNPQQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVL
VLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEE
FRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIID
KLQ

Ligand information

>4qi2 Chain E (length=19) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

auguuuucugugaaaacgg

.<<<<<<<...>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4qi2 Structural basis for RNA recognition in roquin-mediated post-transcriptional gene regulation.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	R188 R219 K220 S238 K239 T240 Q247 Y250 R251 E262 D263 S264 S265
Binding residue (residue number reindexed from 1)	R16 R47 K48 S66 K67 T68 Q75 Y78 R79 E90 D91 S92 S93
Binding affinity	PDBbind-CN: Kd=119nM

Enzymatic activity

Enzyme Commision number

2.3.2.27: RING-type E3 ubiquitin transferase.

External links

PDB	RCSB:4qi2, PDBe:4qi2, PDBj:4qi2
PDBsum	4qi2
PubMed	25026077
UniProt	Q4VGL6\|RC3H1_MOUSE Roquin-1 (Gene Name=Rc3h1)

[Back to BioLiP]