Structure of PDB 4qc3 Chain A Binding Site BS01

Receptor Information
>4qc3 Chain A (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFST
IREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEK
KWTDTFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qc3 Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
V2089 F2139
Binding residue
(residue number reindexed from 1)
V30 F80
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4qc3, PDBe:4qc3, PDBj:4qc3
PDBsum4qc3
PubMed25533489
UniProtQ9UIF8|BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B (Gene Name=BAZ2B)

[Back to BioLiP]