Structure of PDB 4qbm Chain A Binding Site BS01

Receptor Information
>4qbm Chain A (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMHSDLTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTM
RERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHIMRRFFESR
WEEFYQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qbm Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		F1818 V1822 R1832 I1833 Q1870 T1871 F1872 N1873 E1874 D1875
Binding residue
(residue number reindexed from 1)		F25 V29 R39 I40 Q77 T78 F79 N80 E81 D82
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4qbm, PDBe:4qbm, PDBj:4qbm
PDBsum4qbm
PubMed25533489
UniProtQ9UIF9|BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A (Gene Name=BAZ2A)

[Back to BioLiP]