Structure of PDB 4q96 Chain A Binding Site BS01

Receptor Information
>4q96 Chain A (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAK
SNRKLTFLYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKK
PLERLLNIWQERSVYGGEFIQQLKLSMED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4q96 RPRD1A and RPRD1B are human RNA polymerase II C-terminal domain scaffolds for Ser5 dephosphorylation.
Resolution1.85 Å
Binding residue
(original residue number in PDB)
N18 S19 Q20 V23 Y61 N64 D65 Q68 K71
Binding residue
(residue number reindexed from 1)
N16 S17 Q18 V21 Y59 N62 D63 Q66 K69
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4q96, PDBe:4q96, PDBj:4q96
PDBsum4q96
PubMed24997600
UniProtQ9NQG5|RPR1B_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1B (Gene Name=RPRD1B)

[Back to BioLiP]