Structure of PDB 4pz5 Chain A Binding Site BS01

Receptor Information
>4pz5 Chain A (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHE
GGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPI
Ligand information
>4pz5 Chain B (length=14) Species: 224326 (Borreliella burgdorferi B31) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SISYTDEIEEEDYD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pz5 Borrelia burgdorferi Protein BBK32 Binds to Soluble Fibronectin via the N-terminal 70-kDa Region, Causing Fibronectin to Undergo Conformational Extension.
Resolution1.96 Å
Binding residue
(original residue number in PDB)		R83 K85 R99 R101 I102 C104 T105 I106 A107
Binding residue
(residue number reindexed from 1)		R21 K23 R37 R39 I40 C42 T43 I44 A45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005576 extracellular region

View graph for
Cellular Component
External links
PDB RCSB:4pz5, PDBe:4pz5, PDBj:4pz5
PDBsum4pz5
PubMed24962582
UniProtP02751|FINC_HUMAN Fibronectin (Gene Name=FN1)

[Back to BioLiP]