Structure of PDB 4pyw Chain A Binding Site BS01

Receptor Information
>4pyw Chain A (length=362) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADT
HDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSE
GLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDL
VKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMK
RLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDII
TKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVT
LSKAVHKAVLTIDEKGTEAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKS
PLFMGKVVNPTQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pyw An integrative approach combining ion mobility mass spectrometry, X-ray crystallography, and nuclear magnetic resonance spectroscopy to study the conformational dynamics of alpha 1 -antitrypsin upon ligand binding.
Resolution1.91 Å
Binding residue
(original residue number in PDB)		T165 F189 F190 K191 G192 W194 Y244 A336 V337 L338 T339 I340 D341 K343 G344 M374 F384
Binding residue
(residue number reindexed from 1)		T143 F167 F168 K169 G170 W172 Y222 A308 V309 L310 T311 I312 D313 K315 G316 M343 F353
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0002020 protease binding
GO:0004867 serine-type endopeptidase inhibitor activity
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0006953 acute-phase response
GO:0007596 blood coagulation
GO:0010466 negative regulation of peptidase activity
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005783 endoplasmic reticulum
GO:0005788 endoplasmic reticulum lumen
GO:0005794 Golgi apparatus
GO:0030134 COPII-coated ER to Golgi transport vesicle
GO:0031093 platelet alpha granule lumen
GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0043231 intracellular membrane-bounded organelle
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pyw, PDBe:4pyw, PDBj:4pyw
PDBsum4pyw
PubMed26011795
UniProtP01009|A1AT_HUMAN Alpha-1-antitrypsin (Gene Name=SERPINA1)

[Back to BioLiP]