Structure of PDB 4pxi Chain A Binding Site BS01

Receptor Information

>4pxi Chain A (length=194) Species: 1902 (Streptomyces coelicolor) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LRAEQTRATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFAAKE
DLAHAILEIQSRTSRRLAKDLDGRGYSSLEALMRLTFGMARLCVQGPVLR
AGLRLATAPVRPPLPHPFTEWREIATSRLLDAVRQSDVHQDIDVDSVAHT
LVCSVVGTREPRRLAEMWYILIRGMVPVTRRARYVTLAARLEQE

Ligand information

>4pxi Chain E (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atacgggacgccccgtttat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4pxi Structural and functional basis of transcriptional regulation by TetR family protein CprB from S. coelicolor A3(2)
Resolution	3.2 Å
Binding residue (original residue number in PDB)	T42 G44 F48
Binding residue (residue number reindexed from 1)	T38 G40 F44
Binding affinity	PDBbind-CN: Kd=200nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4pxi, PDBe:4pxi, PDBj:4pxi
PDBsum	4pxi
PubMed	25092919
UniProt	O66122

[Back to BioLiP]