Structure of PDB 4pv1 Chain A Binding Site BS01

Receptor Information
>4pv1 Chain A (length=213) Species: 83541 (Mastigocladus laminosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NVYDWFQERLEIQALADDVTSKYVPPHVNIFYCLGGITLTCFLIQFATGF
AMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVF
RVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVS
GVPEAIPVVGVLISDLLRGGSSVGQATLTRYYSAHTFVLPWLIAVFMLLH
FLMIRKQGISGPL
Ligand information
>4pv1 Chain H (length=28) Species: 83541 (Mastigocladus laminosus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EIDVLGWVALLVVFTWSIAMVVWGRNGL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pv1 Traffic within the cytochrome b6f lipoprotein complex: gating of the quinone portal.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
V30 N31 I32
Binding residue
(residue number reindexed from 1)
V28 N29 I30
Enzymatic activity
Catalytic site (original residue number in PDB) R207 I211
Catalytic site (residue number reindexed from 1) R205 I209
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4pv1, PDBe:4pv1, PDBj:4pv1
PDBsum4pv1
PubMed25296314
UniProtP83791|CYB6_MASLA Cytochrome b6 (Gene Name=petB)

[Back to BioLiP]